IVTherapyListing
Find IV Therapy

NAD+ IV Therapy in Lakeland, Florida

Cellular energy, DNA repair, and longevity

$270 – $555 per session~90 minutesLakeland, FL
Book in Lakeland

What is NAD+ IV Therapy?

NAD+ (nicotinamide adenine dinucleotide) is a coenzyme present in every cell, essential for energy metabolism, DNA repair, and the activation of longevity proteins called sirtuins. NAD+ levels decline 50%+ by middle age. IV NAD+ therapy delivers this critical molecule directly to cells at concentrations impossible to achieve orally, supporting cellular regeneration, cognitive function, and anti-aging pathways.

Key Benefits

  • Enhanced cellular energy
  • DNA repair activation
  • Sirtuin (longevity protein) activation
  • Improved cognitive clarity
  • Mood and mental health support
  • Athletic performance
  • Addiction recovery support

Best For

  • Anti-aging and longevity
  • Cognitive performance
  • Chronic fatigue syndrome
  • Athletic recovery
  • Addiction recovery support
  • Neurological health
  • Biohackers and longevity enthusiasts

NAD+ Pricing in Lakeland

Local pricing estimates based on market data for Lakeland, Florida.

Starting From

$270

Typical High

$555

Session Length

90 min

Prices vary by provider, add-ons, and mobile vs. clinic delivery. Mobile services may add a $25–$50 travel fee.

What's in a NAD+ IV Drip?

NAD+ (Nicotinamide Adenine Dinucleotide)Normal SalineOptional: B-ComplexOptional: Amino Acids

NAD+ IV Providers in Lakeland

8 listed

Sage Infusion Lakeland

Medical Clinic
5.0(14 reviews)
1961 E Edgewood Dr suite 102, Lakeland, FL 33803
(863) 777-2528
sageinfusion.com/location/sage-infusion-lakeland-coming-soon/
Book IV Session

Enhanced Lifestyle Healthcare IV Therapy and Spa

IV Bar
5.0(13 reviews)
2125 Harden Blvd, Lakeland, FL 33803
(863) 222-4060
enhancedlifestylespa.com/
Book IV Session

Medic-One Infusions

IV Bar
5.0(9 reviews)
6609 N Socrum Loop Rd, Lakeland, FL 33809
(863) 333-0119
mediconeinfusions.com/
Book IV Session

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL

Wellness Center
5.0(48 reviews)
5143 S Lakeland Dr #2, Lakeland, FL 33813
(863) 900-2081
medspaandwellnesscliniclakelandfl.com/
Book IV Session

Dr. Fusion IV Therapy & Wellness

Wellness Center
5.0(29 reviews)
100 S Kentucky Ave Suite 255, Lakeland, FL 33801
(863) 209-7282
driploungebydrfusion.com/
Book IV Session

Cisne Wellness

Medical Clinic
5.0(103 reviews)
2026 E County Rd 540A, Lakeland, FL 33813
(863) 825-2005
mdl-spa.com/
Book IV Session

LIVE Hydration Spa Lakeland

IV Bar
5.0(133 reviews)
4664 E County Rd 540A, Lakeland, FL 33813
(863) 940-2032
locations.livehydrationspa.com/fl/lakeland/lakeland.html
Book IV Session

IVX Health Infusion Center

Medical Clinic
4.9(54 reviews)
919 Lakeland Park Center Dr Suite 374, Lakeland, FL 33809
(863) 316-3900
ivxhealth.com/locations/florida/lakeland-park?utm_source=extnet&utm_medium=yext
Book IV Session

FAQ — NAD+ IV Therapy in Lakeland

NAD+ IV therapy in Lakeland typically costs between $270 and $555 per session. Mobile IV services may charge an additional travel fee of $25–$50. Prices vary based on add-ons, clinic vs. mobile delivery, and provider.
A NAD+ IV session typically takes 90 minutes from start to finish. Mobile services arrive within 30–60 minutes of booking in most Lakeland locations. You can relax at home, in a hotel, or at the clinic during the infusion.
NAD+ is best for: Anti-aging and longevity, Cognitive performance, Chronic fatigue syndrome, Athletic recovery, Addiction recovery support, Neurological health, Biohackers and longevity enthusiasts. NAD+ (nicotinamide adenine dinucleotide) is a coenzyme present in every cell, essential for energy metabolism, DNA repair, and the activation of longevity proteins called sirtuins.
NAD+ IV therapy is generally safe when administered by a licensed medical professional (RN or NP) at a reputable Lakeland provider. It may not be appropriate for people with: Active cancer (consult oncologist), Pregnancy, Severe liver disease. Always consult your provider before your first session.
Yes — many IV therapy providers in Lakeland offer mobile NAD+ services that come to your home, hotel, or office. Book online and a licensed nurse will arrive with everything needed, typically within 45–90 minutes.

Find IV Therapy Providers in Lakeland

Compare local clinics and mobile IV services. Free, no-obligation quotes.

✓ Free service✓ No spam✓ Licensed providers only