IVList
Find IV Therapy

NAD+ IV Therapy in Lakeland Highlands, Florida

Cellular energy, DNA repair, and longevity

Medically reviewed by Jonathan Belmore, MD|Updated 2026-06-01
$270 – $510 per session~90 minutesLakeland Highlands, FL
Book in Lakeland Highlands

What is NAD+ IV Therapy?

NAD+ (nicotinamide adenine dinucleotide) is a coenzyme present in every cell, essential for energy metabolism, DNA repair, and the activation of longevity proteins called sirtuins. NAD+ levels decline 50%+ by middle age. IV NAD+ therapy delivers this critical molecule directly to cells at concentrations impossible to achieve orally, supporting cellular regeneration, cognitive function, and anti-aging pathways.

Key Benefits

  • Enhanced cellular energy
  • DNA repair activation
  • Sirtuin (longevity protein) activation
  • Improved cognitive clarity
  • Mood and mental health support
  • Athletic performance
  • Addiction recovery support

Best For

  • Anti-aging and longevity
  • Cognitive performance
  • Chronic fatigue syndrome
  • Athletic recovery
  • Addiction recovery support
  • Neurological health
  • Biohackers and longevity enthusiasts

NAD+ Pricing in Lakeland Highlands

Local pricing estimates based on market data for Lakeland Highlands, Florida.

Starting From

$270

Typical High

$510

Session Length

90 min

Prices vary by provider, add-ons, and mobile vs. clinic delivery. Mobile services may add a $25–$50 travel fee.

What's in a NAD+ IV Drip?

NAD+ (Nicotinamide Adenine Dinucleotide)Normal SalineOptional: B-ComplexOptional: Amino Acids

NAD+ IV Providers in Lakeland Highlands

16 listed

Ultra Cryo & Recovery Lakeland

Wellness Center
5.0(321 reviews)
615 Mid-Florida Dr STE 2, Lakeland, FL 33813, USA
(863) 216-6858
ultracryorecovery.com/
Book IV Session

LIVE Hydration Spa Lakeland

MedSpa
5.0(134 reviews)
4664 E County Rd 540A, Lakeland, FL 33813, USA
(863) 940-2032
locations.livehydrationspa.com/fl/lakeland/lakeland.html
Book IV Session

Cisne Wellness

MedSpa
5.0(111 reviews)
2026 E County Rd 540A, Lakeland, FL 33813, USA
(863) 825-2005
mdl-spa.com/
Book IV Session

Medic-One Infusions

IV Bar
5.0(9 reviews)
6609 N Socrum Loop Rd, Lakeland, FL 33809, USA
(863) 333-0119
mediconeinfusions.com/
Book IV Session

RejuvaNu Medspa and Wellness

MedSpa
5.0(58 reviews)
4672 E County Rd 540A, Lakeland, FL 33813, USA
(863) 274-2010
rejuvanumedspa.com/
Book IV Session

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL

MedSpa
5.0(48 reviews)
5143 S Lakeland Dr #2, Lakeland, FL 33813, USA
(863) 900-2081
medspaandwellnesscliniclakelandfl.com/
Book IV Session

Dr. Fusion IV Therapy & Wellness

Wellness Center
5.0(31 reviews)
100 S Kentucky Ave Suite 255, Lakeland, FL 33801, USA
(863) 209-7282
driploungebydrfusion.com/
Book IV Session

Ketamine Clinic Lakeland

Medical Clinic
5.0(52 reviews)
5143 S Lakeland Dr #2, Lakeland, FL 33813, USA
(863) 900-2081
ketaminecliniclakeland.com/
Book IV Session

Sage Infusion Lakeland

Medical Clinic
5.0(15 reviews)
1961 E Edgewood Dr suite 102, Lakeland, FL 33803, USA
(863) 777-2528
sageinfusion.com/location/sage-infusion-lakeland-coming-soon/
Book IV Session

YF Wellness

Wellness Center
5.0(64 reviews)
3715 Drane Field Rd, Lakeland, FL 33811, USA
(863) 225-7460
yfwellness.fit/
Book IV Session

Enhanced Lifestyle Healthcare IV Therapy and Spa

IV Bar
5.0(14 reviews)
2125 Harden Blvd, Lakeland, FL 33803, USA
(863) 222-4060
enhancedlifestylespa.com/
Book IV Session

The Skin Boutique

MedSpa
5.0(109 reviews)
464 W Pipkin Rd #2, Lakeland, FL 33813, USA
(863) 225-2578
tsb.janeapp.com/
Book IV Session

IV DripDash

IV Bar
5.0(1 reviews)
810 Vistabula St, Lakeland, FL 33801, USA
(863) 286-9878
facebook.com/profile.php?id=61581084195260
Book IV Session

IVX Health Infusion Center

Medical Clinic
4.9(56 reviews)
919 Lakeland Park Center Dr Suite 374, Lakeland, FL 33809, USA
(863) 316-3900
ivxhealth.com/locations/florida/lakeland-park?utm_source=extnet&utm_medium=yext
Book IV Session

Premier Solutions

MedSpa
4.9(144 reviews)
6595 Florida Ave S, Lakeland, FL 33813, USA
(863) 593-7804
premiersolutionsweightloss.com/
Book IV Session

Ageless Aesthetics & Wellness

MedSpa
4.9(318 reviews)
242 Lake Harris Dr, Lakeland, FL 33813, USA
(863) 225-5400
agelesslakeland.com/
Book IV Session

FAQ — NAD+ IV Therapy in Lakeland Highlands

NAD+ IV therapy in Lakeland Highlands, Florida typically costs $270–$510 per session. Mobile visits usually add a $25–$50 travel fee, and add-ons or multi-session packages can change the total.
We're still adding NAD+ providers in Lakeland Highlands. Submit a quote request and we'll connect you with available local IV therapy providers as they come online.
A NAD+ IV session in Lakeland Highlands typically takes about 90 minutes, plus 10–15 minutes for intake at your first visit.
NAD+ is most often used for Anti-aging and longevity, Cognitive performance, Chronic fatigue syndrome, Athletic recovery. NAD+ (nicotinamide adenine dinucleotide) is a coenzyme present in every cell, essential for energy metabolism, DNA repair, and the activation of longevity proteins called sirtuins.
NAD+ IV therapy is generally safe when administered by a licensed RN or NP at a reputable Lakeland Highlands provider operating under a medical director. It may not be appropriate for people with Active cancer (consult oncologist), Pregnancy, Severe liver disease — always complete a health intake first.
Our current Lakeland Highlands listings for NAD+ are in-clinic, but mobile IV service is expanding across Florida. Ask local providers about home or hotel delivery, which usually adds a $25–$50 travel fee.

Find IV Therapy Providers in Lakeland Highlands

Compare local clinics and mobile IV services. Free, no-obligation quotes.

✓ Free service✓ No spam✓ Licensed providers only