Ozone IV Therapy IV Therapy in Lakeland Highlands, Florida

Oxygen-rich therapy for cellular regeneration

Medically reviewed by Jonathan Belmore, MD|Updated 2026-06-01

$150 – $350 per session~60 minutesLakeland Highlands, FL

What is Ozone IV Therapy IV Therapy?

Ozone IV therapy (also called Major Autohemotherapy or MAH) involves drawing blood from the patient, exposing it to medical-grade ozone gas, and reinfusing the ozonated blood. Ozone (O3) reacts with blood components to produce bioactive molecules that stimulate antioxidant defense systems, enhance oxygen delivery to tissues, modulate the immune system, and exert antimicrobial effects. Used in integrative medicine for chronic infections, Lyme disease, autoimmune conditions, chronic fatigue, and as a general wellness and anti-aging protocol.

Key Benefits

Enhanced oxygen delivery to tissues
Antioxidant enzyme stimulation
Immune system modulation
Antimicrobial effects
Chronic infection support
Anti-inflammatory activity
Cellular energy enhancement

Best For

Chronic Lyme disease support
Chronic viral infections
Autoimmune condition support
Anti-aging and longevity
Chronic fatigue and fibromyalgia
Mold illness recovery
General integrative wellness

Ozone IV Therapy Pricing in Lakeland Highlands

Local pricing estimates based on market data for Lakeland Highlands, Florida.

Starting From

$150

Typical High

$350

Session Length

60 min

Prices vary by provider, add-ons, and mobile vs. clinic delivery. Mobile services may add a $25–$50 travel fee.

What's in a Ozone IV Therapy IV Drip?

Medical-grade Ozone Gas (O3)Patient's Own Blood (autohemotherapy)Normal Saline (for IV ozone drips)

Ozone IV Therapy IV Providers in Lakeland Highlands

16 listed

Ultra Cryo & Recovery Lakeland

Wellness Center

5.0(321 reviews)

615 Mid-Florida Dr STE 2, Lakeland, FL 33813, USA

(863) 216-6858

ultracryorecovery.com/

Book IV Session

LIVE Hydration Spa Lakeland

MedSpa

5.0(134 reviews)

4664 E County Rd 540A, Lakeland, FL 33813, USA

(863) 940-2032

locations.livehydrationspa.com/fl/lakeland/lakeland.html

Book IV Session

Cisne Wellness

MedSpa

5.0(111 reviews)

2026 E County Rd 540A, Lakeland, FL 33813, USA

(863) 825-2005

mdl-spa.com/

Book IV Session

Medic-One Infusions

IV Bar

5.0(9 reviews)

6609 N Socrum Loop Rd, Lakeland, FL 33809, USA

(863) 333-0119

mediconeinfusions.com/

Book IV Session

RejuvaNu Medspa and Wellness

MedSpa

5.0(58 reviews)

4672 E County Rd 540A, Lakeland, FL 33813, USA

(863) 274-2010

rejuvanumedspa.com/

Book IV Session

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL

MedSpa

5.0(48 reviews)

5143 S Lakeland Dr #2, Lakeland, FL 33813, USA

(863) 900-2081

medspaandwellnesscliniclakelandfl.com/

Book IV Session

Dr. Fusion IV Therapy & Wellness

Wellness Center

5.0(31 reviews)

100 S Kentucky Ave Suite 255, Lakeland, FL 33801, USA

(863) 209-7282

driploungebydrfusion.com/

Book IV Session

Ketamine Clinic Lakeland

Medical Clinic

5.0(52 reviews)

5143 S Lakeland Dr #2, Lakeland, FL 33813, USA

(863) 900-2081

ketaminecliniclakeland.com/

Book IV Session

Sage Infusion Lakeland

Medical Clinic

5.0(15 reviews)

1961 E Edgewood Dr suite 102, Lakeland, FL 33803, USA

(863) 777-2528

sageinfusion.com/location/sage-infusion-lakeland-coming-soon/

Book IV Session

YF Wellness

Wellness Center

5.0(64 reviews)

3715 Drane Field Rd, Lakeland, FL 33811, USA

(863) 225-7460

yfwellness.fit/

Book IV Session

Enhanced Lifestyle Healthcare IV Therapy and Spa

IV Bar

5.0(14 reviews)

2125 Harden Blvd, Lakeland, FL 33803, USA

(863) 222-4060

enhancedlifestylespa.com/

Book IV Session

The Skin Boutique

MedSpa

5.0(109 reviews)

464 W Pipkin Rd #2, Lakeland, FL 33813, USA

(863) 225-2578

tsb.janeapp.com/

Book IV Session

IV DripDash

IV Bar

5.0(1 reviews)

810 Vistabula St, Lakeland, FL 33801, USA

(863) 286-9878

facebook.com/profile.php?id=61581084195260

Book IV Session

IVX Health Infusion Center

Medical Clinic

4.9(56 reviews)

919 Lakeland Park Center Dr Suite 374, Lakeland, FL 33809, USA

(863) 316-3900

ivxhealth.com/locations/florida/lakeland-park?utm_source=extnet&utm_medium=yext

Book IV Session

Premier Solutions

MedSpa

4.9(144 reviews)

6595 Florida Ave S, Lakeland, FL 33813, USA

(863) 593-7804

premiersolutionsweightloss.com/

Book IV Session

Ageless Aesthetics & Wellness

MedSpa

4.9(318 reviews)

242 Lake Harris Dr, Lakeland, FL 33813, USA

(863) 225-5400

agelesslakeland.com/

Book IV Session

FAQ — Ozone IV Therapy IV Therapy in Lakeland Highlands

Ozone IV Therapy IV therapy in Lakeland Highlands, Florida typically costs $150–$350 per session. Mobile visits usually add a $25–$50 travel fee, and add-ons or multi-session packages can change the total.

We're still adding Ozone IV Therapy providers in Lakeland Highlands. Submit a quote request and we'll connect you with available local IV therapy providers as they come online.

A Ozone IV Therapy IV session in Lakeland Highlands typically takes about 60 minutes, plus 10–15 minutes for intake at your first visit.

Ozone IV Therapy is most often used for Chronic Lyme disease support, Chronic viral infections, Autoimmune condition support, Anti-aging and longevity. Ozone IV therapy (also called Major Autohemotherapy or MAH) involves drawing blood from the patient, exposing it to medical-grade ozone gas, and reinfusing the ozonated blood.

Ozone IV Therapy IV therapy is generally safe when administered by a licensed RN or NP at a reputable Lakeland Highlands provider operating under a medical director. It may not be appropriate for people with G6PD deficiency (absolute contraindication), Active bleeding or hemorrhage, Hyperthyroidism (untreated) — always complete a health intake first.

Our current Lakeland Highlands listings for Ozone IV Therapy are in-clinic, but mobile IV service is expanding across Florida. Ask local providers about home or hotel delivery, which usually adds a $25–$50 travel fee.

Find IV Therapy Providers in Lakeland Highlands

Compare local clinics and mobile IV services. Free, no-obligation quotes.